PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009761833.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 544aa    MW: 60839 Da    PI: 6.5602
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009761833.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS452.82.2e-1381755442374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +++L++cA+a s+gdl  aq+l+++l++++s +g+p+qRl ay++e+L arla s+s++yk+l+++e +   s e l+++++++ev+P++kf+++
  XP_009761833.1 175 KRVLIACAKAESDGDLLTAQWLISELRQMVSVSGEPIQRLGAYILEGLVARLATSGSSIYKSLRCKEPA---SFELLSYMHILHEVCPYFKFGYM 266
                     789*****************************************************************9...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      aN aI ea++ e+rvHiiDf+isqG QW++L+qa+a+Rp+gpp++RiTg+++++s   +   l+ +g+rL+k+Ae+++vpfef++ +a +++d+
  XP_009761833.1 267 SANGAIAEAMKDEQRVHIIDFQISQGSQWVTLIQAFAARPGGPPHIRITGIDDSKSAyaRGGGLNIIGKRLSKLAESFKVPFEFHA-AAISTSDV 360
                     *****************************************************888899999************************.8999**** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     +le+L ++pgEalaVn+++ lh+++desvs+e++rd++++lvksl+Pkvv++veqe+++n++ F+ rfle l+yy+a+f+s++a+l+r+++eri+
  XP_009761833.1 361 QLENLGIRPGEALAVNFAFVLHHMPDESVSTENHRDRLIRLVKSLNPKVVTLVEQESNTNTAAFFPRFLEMLDYYTAMFESIDATLSRAHKERIN 455
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     vE+++l+++ivn++aceg er+erhe l+kW++r+++aGF+p+pls+ +++++k+l++++ +  yr+ee++g+l+lgW++r Lv+ +aW+
  XP_009761833.1 456 VEQHCLAKDIVNIIACEGIERVERHELLGKWKSRFRMAGFSPYPLSSLVNSTIKALVENYCD-KYRLEERDGALYLGWMNRDLVASCAWK 544
                     ************************************************************95.5*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.16148525IPR005202Transcription factor GRAS
PfamPF035147.8E-136175544IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MQASQRLRRS AKSDTLYQSV QKTEASYLPQ FQTLDTQMTS INRTQGGNHS IQTYSDRYCT  60
MESSSPTGKY VVQNSISAVS FTPNGSPTSH QESQSCLSDV HYSPDTNYNS PVSGSCITDD  120
VNDFRHKLKE LETVMLGPNS DVLDSCDNSL PSCMTSPEID CWRQMMEAIP RGDLKRVLIA  180
CAKAESDGDL LTAQWLISEL RQMVSVSGEP IQRLGAYILE GLVARLATSG SSIYKSLRCK  240
EPASFELLSY MHILHEVCPY FKFGYMSANG AIAEAMKDEQ RVHIIDFQIS QGSQWVTLIQ  300
AFAARPGGPP HIRITGIDDS KSAYARGGGL NIIGKRLSKL AESFKVPFEF HAAAISTSDV  360
QLENLGIRPG EALAVNFAFV LHHMPDESVS TENHRDRLIR LVKSLNPKVV TLVEQESNTN  420
TAAFFPRFLE MLDYYTAMFE SIDATLSRAH KERINVEQHC LAKDIVNIIA CEGIERVERH  480
ELLGKWKSRF RMAGFSPYPL SSLVNSTIKA LVENYCDKYR LEERDGALYL GWMNRDLVAS  540
CAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-601785448375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009761823.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009761833.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLK4CEZ90.0K4CEZ9_SOLLC; Uncharacterized protein
STRINGSolyc07g047950.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein